PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009602857.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 753aa    MW: 82825 Da    PI: 5.9799
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009602857.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox665.2e-2155110156
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     +++ +++t++q++eLe+lF+++++p++++r eL+k+l+L++rqVk+WFqNrR+++k
  XP_009602857.1  55 KKRYHRHTPQQIQELESLFKECPHPDEKQRLELSKRLSLETRQVKFWFQNRRTQMK 110
                     688999***********************************************999 PP

2START202.41.9e-632624861206
                     HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEE CS
           START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetl 82 
                     ela++a++e+vk+a+ +ep+W++s+    e++n +e++++f++  +     + +ea+r++g+v+ ++  lve+l+d++ +W e+++    + +t+
  XP_009602857.1 262 ELALAAMDEFVKMAQTDEPLWFRSVeggrEILNHEEYMRSFTSCIGmrpnsFVSEASRETGMVIINSLALVETLMDSN-KWAEMFPcliaRTSTT 355
                     5899*************************************988889***9***************************.**************** PP

                     EEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-E CS
           START  83 evissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehv 170
                     +vissg      galqlm aelq+lsplvp R++ f+R+++q+ +g+w++vdvS+d  ++ ++ + +  ++ lpSg+l+++++ng+skvtwveh 
  XP_009602857.1 356 DVISSGmggtrnGALQLMHAELQVLSPLVPiREVNFLRFCKQHAEGVWAVVDVSIDTIRETSNAPTFPNSRILPSGCLVQDMPNGYSKVTWVEHG 450
                     *************************************************************99******************************** PP

                     E--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 171 dlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                     +++++++h l+r+l++ g+ +ga++wvatlqrqce+
  XP_009602857.1 451 EYDESVIHHLYRPLISAGMGFGAQRWVATLQRQCEC 486
                     **********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.3E-2041112IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.4E-2141106IPR009057Homeodomain-like
PROSITE profilePS5007117.63752112IPR001356Homeobox domain
SMARTSM003895.2E-1953116IPR001356Homeobox domain
CDDcd000864.74E-1954112No hitNo description
PfamPF000461.5E-1855110IPR001356Homeobox domain
PROSITE patternPS00027087110IPR017970Homeobox, conserved site
PROSITE profilePS5084842.638253489IPR002913START domain
SuperFamilySSF559612.47E-32255486No hitNo description
CDDcd088751.24E-124257485No hitNo description
PfamPF018524.5E-55262486IPR002913START domain
SMARTSM002345.0E-48262486IPR002913START domain
SuperFamilySSF559611.83E-23505739No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009827Biological Processplant-type cell wall modification
GO:0042335Biological Processcuticle development
GO:0043481Biological Processanthocyanin accumulation in tissues in response to UV light
GO:0048765Biological Processroot hair cell differentiation
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 753 aa     Download sequence    Send to blast
MEGQSEVTRM AENYEGNNSN GRRSREEEPD SRSGSDNLEG ASGDDQDAAD KPPRKKRYHR  60
HTPQQIQELE SLFKECPHPD EKQRLELSKR LSLETRQVKF WFQNRRTQMK TQLERHENSI  120
LRQENDKLRA ENMSIREAMR NPICTNCGGP AMIGEISLEE QHLRIENARL KDELDRVCAL  180
AGKFLGRPIS SLVNSMPPPM PNSSLELGVG NNGFGGLSNV PSTLPLAPPD FGVGISNSLP  240
VVASTRQTTG IERSLERSMY LELALAAMDE FVKMAQTDEP LWFRSVEGGR EILNHEEYMR  300
SFTSCIGMRP NSFVSEASRE TGMVIINSLA LVETLMDSNK WAEMFPCLIA RTSTTDVISS  360
GMGGTRNGAL QLMHAELQVL SPLVPIREVN FLRFCKQHAE GVWAVVDVSI DTIRETSNAP  420
TFPNSRILPS GCLVQDMPNG YSKVTWVEHG EYDESVIHHL YRPLISAGMG FGAQRWVATL  480
QRQCECLAIL MSSTVSSRDH TAITPSGRRS MLKLAQRMTN NFCAGVCAST VHKWNKLCAG  540
NVDEDVRVMT RKSVDDPGEP PGIVLSAATS VWLPISPQRL FDFLRDERLR SEWDILSNGG  600
PMQEMAHIAK GQDHGNCVSL LRASAINANQ SSMLILQETC IDAAGALVVY APVDIPAMHV  660
VMNGGDSAYV ALLPSGFSIV PDGPGSRGSS TANCGSNNDG PDQRISGSLL TVAFQILVNS  720
LPTAKLTVES VETVNNLISC TVQKIKAALH CES
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00421DAPTransfer from AT4G00730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ2221850.0GQ222185.1 Solanum lycopersicum cultivar M82 cutin deficient 2 (CD2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009602856.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like isoform X1
RefseqXP_016490208.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLK4AZA30.0K4AZA3_SOLLC; Uncharacterized protein
STRINGSolyc01g091630.2.10.0(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein